apodictic
clearly established or beyond dispute.Origin
mid 17th century: via Latin from Greek , from ‘show off, demonstrate’.
regard
Middle English: from Old French regarder‘to look at fully’, from re- ‘back’ (also expressing intensive force) + garder ‘to guard’.
Psithurism
the sound of wind whispering through the trees
devil
origin from dia ‘across’ + ballein ‘to throw’
alterity
PRONUNCIATION:(al-TER-uh-tee)
MEANING:noun: Otherness: the state or quality of being other or different.
ETYMOLOGY:From French altérité, from Latin alteritas (otherness), from alter (other), from Greek heteros (other). Earliest documented use: 1500.
Scarborough warning
PRONUNCIATION:(SKAR-buh-ruh war-ning)
MEANING:noun: A very short notice or no notice.
ETYMOLOGY:After Scarborough, a town on the northeast coast of the UK. It’s unclear how Scarborough became associated with this idea though one conjecture is about robbers being given summary punishment. Earliest documented use: 1546.
misocainea
PRONUNCIATION:(mis-oh-KY-nee-uh, mi-soh-)
MEANING:noun: A hatred of new ideas.
ETYMOLOGY:From Greek miso- (hate) + -cainea (new). Earliest documented use: 1938.
euphoria
Origin: late 17th century (denoting well-being produced in a sick person by the use of drugs): modern Latin, from Greek, from euphoros ‘borne well, healthy’, from eu ‘well’ + pherein ‘to bear’.
psychogenic
PRONUNCIATION:(sy-kuh-JEN-ik)
MEANING:adjective: Originating in the mind (having a psychological rather than a physiological cause).
ETYMOLOGY:From Greek psycho- (mind) + -genic (producing). Earliest documented use: 1897.
philargyry
PRONUNCIATION:(fil-ARJ-uh-ree)

MEANING:: The love of money; greed.noun
ETYMOLOGY:From Greek phil- (love) + argyros (silver). Ultimately from the Indo-European root arg- (to shine; white) that is also the source of argue (from Latin arguere, to make clear), (clayey), and French argent (money). The word also appears in the chemical symbol for silver (Ag) and in the name of the country Argentina (where flows Rio de la Plata, Spanish for “river of silver”). Earliest documented use: 1529.
metonymy
PRONUNCIATION:(muh-TAHN-uh-mee)

MEANING:: A figure of speech in which someone or something is referred to by the name of something associated.For example, the use of the word to refer to. noun crown monarchy
ETYMOLOGY:From Latin metonymia, from Greek metonymia (change of name), from meta- (after, beyond) + onama (name). Ultimately from the Indo-European root no-men- (name) which also gave us name, anonymous, noun, synonym, eponym, renown, nominate, misnomer, moniker, and ignominy. Earliest documented use: 1553.
logorrhea
lôɡəˈrēə/Learn to pronouncenoun: logorrhoea; noun: logorrhea
- a tendency to extreme loquacity (aka “diarrhea of the mouth”).
Origin: early 20th century: from Greek logos ‘word’ + rhoia ‘flow’.
Epicene
ep·i·cene/ˈepəˌsēn/epicene
- having characteristics of both sexes or no characteristics of either sex; of indeterminate sex.”the sort of epicene beauty peculiar to boys of a certain age”Similar:sexlessasexualneuterunsexedandrogynoushermaphroditeandrogynemonoclinousgynandrousgynandromorphicparthenogenetic
- effeminate; effete.”the actor infused the role with an epicene languor”Similar:effeminatewomanishunmanlyunmasculinegirlisheffeteweaknamby-pambysissygirlycamplimp-wristednancypansifiedqueenyOpposite:masculinemacho
nounnoun: epicene; plural noun: epicenes
- an epicene person.
Origin: late Middle English (as a grammatical term): via late Latin from Greek epikoinos (based on koinos ‘common’).
supercargo
PRONUNCIATION:(soo-puhr-KAHR-goh)
MEANING:noun:
1. An officer on a merchant ship who is in charge of the cargo.
2. A superintendent or an agent.
ETYMOLOGY:By alteration of supracargo, from Spanish sobrecargo, from sobre (over), from Latin super (super) + cargo. Earliest documented use: 1667.
ithyphallic
PRONUNCIATION:(ith-uh-FAL-ik)
MEANING:adjective:
1. Lewd or salacious.
2. Having an erect phallus.
ETYMOLOGY:From Latin ithyphallicus, from Greek ithyphallikos, from ithyphallos, from ithys (straight) + phallos (phallus). Earliest documented use: 1795.
epigenetics is the study of heritable phenotype changes that do not involve alterations in the DNA sequence. The Greek prefix epi- (ἐπι- “over, outside of, around”) in epigenetics implies features that are “on top of” or “in addition to” the traditional genetic basis for inheritance.
Simon Legree
PRONUNCIATION:(SY-muhn li-GREE)
MEANING:noun: A harsh taskmaster.
ETYMOLOGY:After Simon Legree, a brutal slaveholder in the novel Uncle Tom’s Cabin by Harriet Beecher Stowe (1811-1896). Simon Legree has Uncle Tom, an enslaved man, whipped to death for refusing to divulge the whereabouts of two enslaved women who had escaped to freedom. Earliest documented use: 1857.
syzygy
noun: syzygy; plural noun: syzygies
- a conjunction or opposition, especially of the moon with the sun. “the planets were aligned in syzygy.
a pair of connected or corresponding things.”animus and anima represent a supreme pair of opposites, the syzygy”Origin: early 17th century: via late Latin from Greek suzugia, from suzugos ‘yoked, paired’, from sun- ‘with, together’ + the stem of zeugnunai ‘to yoke’.
kenosis
In Christian theology, kenosis (Greek: κένωσις, kénōsis, lit. [the act of emptying]) is the ‘self-emptying’ of Jesus’ own will and becoming entirely receptive to God’s divine will.
handfast
PRONUNCIATION:(HAND-fast)

MEANING:noun: A contract or agreement, especially about a betrothal or marriage.
verb tr.: To engage to be married or to bind in wedlock.
ETYMOLOGY:From Old English handfæsten (to pledge or betroth), from hand + fæstan (to fasten). Earliest documented use: 1275.
chrysocracy
PRONUNCIATION:(kri-SAH-kruh-see)

MEANING:noun: Rule by the wealthy.
ETYMOLOGY:From Greek chryso- (gold) + -cracy (rule). Earliest documented use: 1828. A synonym is plutocracy.
zeitgeber/ˈtsītˌɡābər
PHYSIOLOGY noun: zeitgeber; plural noun: zeitgebers
- a rhythmically occurring natural phenomenon which acts as a cue in the regulation of the body’s circadian rhythms.
Origin: 1950s: from German Zeitgeber, from Zeit ‘time’ + Geber ‘giver’.
bismillah/bisˈmilə/
In the name of Allah (an invocation used by Muslims at the beginning of any undertaking).
manumission
PRONUNCIATION:(man-yuh-MISH-uhn)
MEANING:: Release from slavery, servitude, or restraint.noun
ETYMOLOGY:From Latin manumittere (to free), from manus (hand) + mittere (to let go). Ultimately from the Indo-European root man- (hand), which also gave us manual, manage, maintain, manicure, maneuver, manufacture, manuscript, command, manure, , , and . Earliest documented use: 1452.manquelegerdemainmortmain

proditomania
homophily
-
the tendency for people to seek out or be attracted to those who are similar to themselves.“homophily by gender was common in most groups”
cadre
-
a small group of people specially trained for a particular purpose or profession.“a small cadre of scientists”Similar: small group, body, team, corps, core, nucleus, key group
-
a group of activists in a communist or other revolutionary organization.
-
a member of an activist group.
-
eustress
-
1.the complete final destruction of the world, as described in the biblical book of Revelation.
-
(especially in the Vulgate Bible) the book of Revelation.singular proper noun: Apocalypse
-
-
2.an event involving destruction or damage on an awesome or catastrophic scale.“a stock market apocalypse”
Loyal
adjective /lɔɪəl/ always liking and supporting someone or something: a loyal supporter. She’s very loyal to her friends. (Definition of “loyal” from the CambridgeEssential Dictionary © Cambridge University Press) Etymology: mid 16th century: from French, via Old French loial from Latin legalis (see legal).
satyagraha
PRONUNCIATION: (suh-TYAH-gruh-uh, sut-YAH-gru-ha)
MEANING: The policy of passive nonviolent resistance as a protest against injustice.noun
ETYMOLOGY: Coined by Mahatma Gandhi (1869-1948) in India’s freedom struggle, from Sanskrit satyagraha, from satyam (truth) + agraha (determination, insistence), ultimately from the Indo-European root ghrebh- (to seize or reach), which also gave us grasp and grab. Earliest documented use: 1920.
pedantic
PRONUNCIATION: (puh-DAN-tik)
MEANING: Characterized by an excessive, narrow adherence to rules without practical judgment.adjective
ETYMOLOGY: From French pédant or Italian pedante, perhaps from Latin paedagogare (to teach). Earliest documented use: 1607.
Godwin’s law
Coined by Mike Godwin (b. 1956). Earliest documented use: 1991.
Evanescence: After you lose a loved one, often you’re gripped with a fear of evanescence, or the rapid fading from sight or memory of that person. Evanescence comes from the Latin evanescere meaning “disappear, vanish.” Something that possesses qualities of evanescence, has a quality of disappearing or vanishing.Nostalgia is a sentimentality for the past, typically for a period or place with happy personal associations.[1] The word nostalgia is learned formation of a Greek compound, consisting of νόστος (nóstos), meaning “homecoming”, a Homeric word, and ἄλγος(álgos), meaning “pain” or “ache”, and was coined by a 17th-century medical student to describe the anxieties displayed by Swiss mercenaries fighting away from home.[2] (Wikipedia.org)
Socratic irony
John Longanecker; Electric Map Impressive; Gettysburg Times (Pennsylvania); Jun 10, 2016.
Socratic method
horripilation
A bristling of the hair on the skin from cold, fear, etc.; goose bumps.(contributed by Michael Kelly)
exteroception
sensitivity to stimuli originating outside of the body. sensitivity, sensitiveness, sensibility – (physiology) responsiveness to external stimuli; the faculty of sensation; “sensitivity to pain” visual modality, visual sense, vision, sight – the ability to see; the visual faculty.
interoceptive
1. relating to stimuli produced within an organism, especially in the gut and other internal organs.
omertà
cabal
-
-
-
a secret political clique or faction,
- “a cabal of dissidents”
-
Origin: late 16th century (denoting the Kabbalah): from French cabale, from medieval Latin cabala (see Kabbalah).
-
omphaloskepsis
PRONUNCIATION:(om-fuh-lo-SKEP-sis)
boudoir
-
a woman’s bedroom or private room.
Origin: late 18th century: French, literally ‘sulking-place’, from bouder ‘pout, sulk’.
Mindfield: Richard Branam’s coined word for the sometimes minefield of the construct field (C-field as taught in Prosperos classes).
Postmodernism: Postmodernism does not say there is no truth, only that there is no relative truth. And that our relative truths need to be deconstructed, much like we do in Translation, much like Socrates did.
Anarchy: It does not mean without rules. It means without rulers, masters. Where everyone is equally responsible for the functioning of the whole. Much like a group-centered group as opposed to a leader-centered group. Anarchy would be the former.
-
The sympathetic nervous system (SNS) is part of the autonomic nervous system (ANS), which also includes the parasympathetic nervous system (PNS). The sympathetic nervous system activates what is often termed the fight or flight response.
-
The parasympathetic nervous system is one of three divisions of the autonomic nervous system. Sometimes called the rest and digest system, the parasympathetic system conserves energy as it slows the heart rate, increases intestinal and gland activity, and relaxes sphincter muscles in the gastrointestinal tract.
homeostasis
-
the tendency toward a relatively stable equilibrium between interdependent elements, especially as maintained by physiological processes.
nocebo
-
a detrimental effect on health produced by psychological or psychosomatic factors such as negative expectations of treatment or prognosis.
Origin: 1960s: from Latin, literally ‘I shall cause harm,’ from nocere, ‘to harm,’ on the pattern of placebo .
anecdote
doctor: The root of the word doctor is docile (according to Parkinson’s Origins: A Short Etymological Dictionary of Modern English)
doks
/däks/
-
search for and publish private or identifying information about (a particular individual) on the Internet, typically with malicious intent.“hackers and online vigilantes routinely dox both public and private figures”
eucatastrophe:
rompe l’oeil:
2. A painting, mural, etc., made in this style.
ETYMOLOGY: From French, literally “fools the eye”, from tromper (to deceive) + le (the) + oeil (eye). Earliest documented use: 1889.
Pascal’s Wager
…is an argument in philosophy presented by the seventeenth-century French philosopher, mathematician and physicist BlaisePascal (1623–62). It posits that humans bet with their lives that God either exists or does not.
Mens rea:
Mens rea is the mental element of a person’s intention to commit a crime; or knowledge that one’s action or lack of action would cause a crime to be committed. It is a necessary element of many crimes. Wikipedia
mindful fucking
Having sex with the whole person rather than just a body.
artilect
NOUN: A MACHINE OR ROBOT POSSESSING ARTIFICIAL INTELLIGENCE, ESPECIALLY TO A DEGREE COMPARABLE WITH HUMAN INTELLIGENCE.
Origin: 1990s; earliest use found in Usenet (newsgroups). From arti- + -lect (artificial + intellect).
ephebe
-
(in ancient Greece) a young man of 18–20 years undergoing military training.
louche
adjective: louche; comparative adjective: loucher; superlative adjective: louchest
-
disreputable or sordid in a rakish or appealing way.“the louche world of the theater”
Origin: early 19th century: from French, literally ‘squinting.’
witch derives from the word victim (Partridge’s “Origins”)
qualia
nescient
neSH(ē)ənt,ˈnesēənt/
adjective: nescient
-
lacking knowledge; ignorant.“I ventured into the new Korean restaurant with some equally nescient companions”
Origin:
MEANING: noun: Knowledge that cannot be obtained by normal means.
ETYMOLOGY: From Greek para- (beyond) + gnosis (knowledge). Earliest documented use: 1933.
chin music
-
1.idle chatter.
-
2.BASEBALLused to refer to a pitched ball that passes very close to the batter’s chin.“Clemens delivered some wicked chin music to Hernandez”
anagnorisis
Anthony Quinn; Film: Puddle Deep, Mountain High; The Independent(London, UK); Dec 26, 2003.
Kathleen Parker; Let’s Put Right-wing Conspiracy Issue to Rest; The Grand Rapids Press (Michigan); Mar 21, 2002.
obverse
noun: | 1. The side of a coin, medal, etc. that has the main design. |
2. The front or the principal side of anything. | |
3. A counterpart to something. | |
adjective: | 1. Facing the observer. |
2. Serving as a counterpart to something. |
ETYMOLOGY:
NOTES:
USAGE:
metanoia
MEANING:
ETYMOLOGY:
heretic: from the Greek hairetikos meaning “able to choose.”
pattern: is from the Latin pater, meaning father.
carcinoma: a malignant tumor of epithelial origin.
epithelium and feminine derive from the Greek thele, meaning nipple.
masturbation: disturbing male seed.
orthodoxy: straight thinking.
philanthropy: lover of mankind.
apocalypse: from Greek, meaning an unveiling, a moment in which something is revealed that changes our perception of everything (definition via Nathan Schneider)
idiot: comes from Greek idios which means “one’s own, peculiar to oneself.” We see it in our English word idiosyncrasy and idiomatic—and it is where we get the word idiot, or a person who is consumed with himself.
approve: from prove which comes from pro- meaning in favor and bus meaning to be. So approve means to be in favor of being.
diagnosis: from Greek dia- meaning through and Greek gnosis meaning knowing.
peripatetic: disciple of Aristotle from Greek peripatetikos “given to walking about” (especially while teaching), from peripatein, from peri– “around” + patein“to walk.” Aristotle’s custom was to teach while strolling through the Lyceum in Athens.
gullible: from Middle English cull meaning to pluck or gather.
reify: to regard (something abstract) as a material or concrete thing.
debt: from Latin debere meaning to to owe, originally, to keep something away from someone.
experience: from Latin periculum meaning to attempt or to fail, also fear. An expert is one who has experienced.
restaurant: from French restaurer meaning to restore
infant: comes from Latin infans meaning without speech
axiom: comes from Greek axios meaning worthy
atom: comes from the Latin atomus meaning indivisible
bad: comes from the Old English baeddel meaning effeminate man